RPS6KL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81226

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS6KL1 Antibody - BSA Free

Western Blot: RPS6KL1 Antibody [NBP1-81226]

Western Blot: RPS6KL1 Antibody [NBP1-81226]

Western Blot: RPS6KL1 Antibody [NBP1-81226] - Analysis in control (vector only transfected HEK293T lysate) and RPS6KL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RPS6KL1 Antibody [NBP1-81226]

Immunocytochemistry/ Immunofluorescence: RPS6KL1 Antibody [NBP1-81226]

Immunocytochemistry/Immunofluorescence: RPS6KL1 Antibody [NBP1-81226] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry: RPS6KL1 Antibody [NBP1-81226]

Immunohistochemistry: RPS6KL1 Antibody [NBP1-81226]

Immunohistochemistry: RPS6KL1 Antibody [NBP1-81226] - Staining of human cerebellum shows nucleolar positivity in Purkinje cells.

Applications for RPS6KL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS6KL1

Alternate Names

EC 2.7.11.1, FLJ35734, MGC11287, ribosomal protein S6 kinase-like 1

Gene Symbol

RPS6KL1

Additional RPS6KL1 Products

Product Documents for RPS6KL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS6KL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS6KL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS6KL1 Antibody - BSA Free and earn rewards!

Have you used RPS6KL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPS6KL1 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: I wish to purchase an antibody from you, RPS6KL1 antibody NBP1-81226. Your antibody would be highly useful to me because it is validated in IF as well as in Western Blots. But, you only seem to be selling sizes in 0.1 ml and I do not anticipate needing quite so much antibody, especially one that has no publications and no reviews. Do you have a sample size available for this product?

    A: I am very sorry, but we currently do not have a smaller size available for this product at this time. This is a product that we produce under license from the Human Protein Atlas, and as such, it has been very well characterized. You can see all the testing performed.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...