Ryanodine Receptor 1 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-71610

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Ryanodine Receptor 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Ryanodine Receptor 1 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Ryanodine Receptor 1

The Ryanodine Receptor (RyR) is the channel responsible for the release of calcium from the sarcoplasmic reticulum (SR) in muscle cells and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains; the remainder of the protein, termed the "foot" region is located in the cytoplasm between the T-tubule and the SR. The mammalian RyR is the product of three different genes: RyR 1, which is expressed predominantly in skeletal muscle and areas of the brain, RyR 2, which is expressed predominantly in the heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain, and RyR-3 which is found in smooth muscle and the brain (striatum, thalamus and hippocampus).

Long Name

Ryanodine receptor 1

Alternate Names

RYDR, RYR-1, RyR1

Gene Symbol

RYR1

Additional Ryanodine Receptor 1 Products

Product Documents for Ryanodine Receptor 1 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ryanodine Receptor 1 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ryanodine Receptor 1 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Ryanodine Receptor 1 Antibody [Biotin] and earn rewards!

Have you used Ryanodine Receptor 1 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies