SAP130 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92362

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SAP130 Antibody - BSA Free

Western Blot: SAP130 Antibody [NBP1-92362]

Western Blot: SAP130 Antibody [NBP1-92362]

Western Blot: SAP130 Antibody [NBP1-92362] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SAP130 Antibody [NBP1-92362]

Immunohistochemistry-Paraffin: SAP130 Antibody [NBP1-92362]

Immunohistochemistry-Paraffin: SAP130 Antibody [NBP1-92362] - Staining of human colon shows strong nuclear positivity in glandular cells.
Western Blot: SAP130 Antibody [NBP1-92362]

Western Blot: SAP130 Antibody [NBP1-92362]

Western Blot: SAP130 Antibody [NBP1-92362] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
SAP130 Antibody - BSA Free Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Staining of human lymphoid tissues shows strong nuclear positivity in non-germinal center cells.
SAP130 Antibody - BSA Free Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Staining of human endometrium shows moderate nuclear positivity in glandular cells.
SAP130 Antibody - BSA Free Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Staining of human rectum shows strong nuclear positivity in glandular cells.
SAP130 Antibody - BSA Free Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Immunohistochemistry: SAP130 Antibody - BSA Free [NBP1-92362]

Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
SAP130 Antibody - BSA Free Western Blot: SAP130 Antibody - BSA Free [NBP1-92362]

Western Blot: SAP130 Antibody - BSA Free [NBP1-92362]

Analysis in human cell line A-431.

Applications for SAP130 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAP130

SAP130 encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Alternate Names

KIAA0017splicing factor 3b, subunit 3, 130kD, Pre-mRNA-splicing factor SF3b 130 kDa subunit, RSE1, SAP130SAP 130, SF3B130, SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit, Spliceosome-associated protein 130, splicing factor 3B subunit 3, splicing factor 3b, subunit 3, 130kDa, STAF130

Gene Symbol

SF3B3

Additional SAP130 Products

Product Documents for SAP130 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAP130 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAP130 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAP130 Antibody - BSA Free and earn rewards!

Have you used SAP130 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...