SAP18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88212

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SAP18. Peptide sequence: EIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SAP18 Antibody - BSA Free

Western Blot: SAP18 Antibody [NBP2-88212]

Western Blot: SAP18 Antibody [NBP2-88212]

Western Blot: SAP18 Antibody [NBP2-88212] - WB Suggested Anti-SAP18 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Immunohistochemistry-Paraffin: SAP18 Antibody [NBP2-88212]

Immunohistochemistry-Paraffin: SAP18 Antibody [NBP2-88212]

Immunohistochemistry-Paraffin: SAP18 Antibody [NBP2-88212] - Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue. Observed Staining: Cytoplasm in spermatogonia and spermatocytes.

Applications for SAP18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAP18

Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter.

Alternate Names

2HOR0202cell growth inhibiting protein 38, Cell growth-inhibiting gene 38 protein, cell growth-inhibiting protein 38, histone deacetlyase complex subunit SAP18, histone deacetylase complex subunit SAP18,18 kDa Sin3-associated polypeptide, MGC27131, SAP18p, Sin3A-associated protein, 18kDa, Sin3-associated polypeptide p18, sin3-associated polypeptide, 18 kDa, sin3-associated polypeptide, p18

Gene Symbol

SAP18

Additional SAP18 Products

Product Documents for SAP18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAP18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAP18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAP18 Antibody - BSA Free and earn rewards!

Have you used SAP18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...