SAR1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33521

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SAR1B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SAR1B Antibody - BSA Free

Western Blot: SAR1B Antibody [NBP2-33521]

Western Blot: SAR1B Antibody [NBP2-33521]

Western Blot: SAR1B Antibody [NBP2-33521] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue
Immunohistochemistry: SAR1B Antibody [NBP2-33521]

Immunohistochemistry: SAR1B Antibody [NBP2-33521]

Immunohistochemistry: SAR1B Antibody [NBP2-33521] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Applications for SAR1B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAR1B

SAR1B belongs to the small GTPase superfamily, SAR1 family. It is involved in transport from the endoplasmic reticulum to the Golgi apparatus and is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex. Defects in SAR1B are the cause of chylomicron retention disease (CMRD). CMRD is an autosomal recessive disorder of severe fat malabsorption associated with failure to thrive in infancy. The conditions are characterized by deficiency of fat-soluble vitamins, low blood cholesterol levels, and a selective absence of chylomicrons from blood. Affected individuals accumulate chylomicron-like particles in membrane-bound compartments of enterocytes, which contain large cytosolic lipid droplets.

Alternate Names

2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB

Gene Symbol

SAR1B

UniProt

Q9Y6B6 (Human)

Additional SAR1B Products

Product Documents for SAR1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SAR1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAR1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAR1B Antibody - BSA Free and earn rewards!

Have you used SAR1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies