SART1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89024

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SART1 Antibody - BSA Free

Western Blot: SART1 Antibody [NBP1-89024]

Western Blot: SART1 Antibody [NBP1-89024]

Western Blot: SART1 Antibody [NBP1-89024] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: SART1 Antibody [NBP1-89024]

Immunocytochemistry/ Immunofluorescence: SART1 Antibody [NBP1-89024]

Immunocytochemistry/Immunofluorescence: SART1 Antibody [NBP1-89024] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SART1 Antibody [NBP1-89024]

Immunohistochemistry-Paraffin: SART1 Antibody [NBP1-89024]

Immunohistochemistry-Paraffin: SART1 Antibody [NBP1-89024] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: SART1 Antibody [NBP1-89024]

Western Blot: SART1 Antibody [NBP1-89024]

Western Blot: SART1 Antibody [NBP1-89024] - Analysis in cell lysates from prostate cancer cell lines. Image from a verified customer review.

Applications for SART1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. SART1 antibody validated for WB from a verified customer review.

Reviewed Applications

Read 1 review rated 5 using NBP1-89024 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SART1

SART1, also known as hypoxia-associated factor (HAF), encodes two proteins, the SART1(800) protein expressed in the nucleus of the majority of proliferating cells, and the SART1(259) protein expressed in the cytosol of epithelial cancers. The SART1(259) protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1(259) protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1(259) antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1(259) protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway. [provided by RefSeq]

Long Name

Squamous cell carcinoma antigen recognized by T cells

Alternate Names

Ara1, HAF, HOMS1, IgE Autoantigen, SART1259, SNRNP110, Snu66

Gene Symbol

SART1

Additional SART1 Products

Product Documents for SART1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SART1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for SART1 Antibody - BSA Free

Customer Reviews for SART1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SART1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • SART1 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Cell lysates from prostate cancer cell lines
    Species: Human
    Verified Customer | Posted 12/14/2017
    Dilution of SART1 Ab: 1:1000 in 1% BSA in TBST at 4*C for 14 hours.
    Dilution of SART1 Ab: 1:1000 in 1% BSA in TBST at 4*C for 14 hours.
    SART1 Antibody - BSA Free NBP1-89024

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

HIF Enhancer Pathways HIF Enhancer Pathway Thumbnail