SCOT2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93673

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1). QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SCOT2 Antibody - Azide and BSA Free

Western Blot: SCOT2 AntibodyAzide and BSA Free [NBP2-93673]

Western Blot: SCOT2 AntibodyAzide and BSA Free [NBP2-93673]

Western Blot: SCOT2 Antibody [NBP2-93673] - Western blot analysis of extracts of various cell lines, using SCOT2 Rabbit pAb (NBP2-93673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry: SCOT2 Antibody - Azide and BSA Free [NBP2-93673]

Immunohistochemistry: SCOT2 Antibody - Azide and BSA Free [NBP2-93673]

Immunohistochemistry: SCOT2 Antibody [NBP2-93673] - Analysis of mouse testis using SCOT2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: SCOT2 Antibody - Azide and BSA Free [NBP2-93673]

Immunohistochemistry: SCOT2 Antibody - Azide and BSA Free [NBP2-93673]

Immunohistochemistry: SCOT2 Antibody [NBP2-93673] - Analysis of rat testis using SCOT2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for SCOT2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SCOT2

OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization. See also OXCT1 (MIM 601424).[supplied by OMIM]

Alternate Names

3-oxoacid CoA transferase 2, 3-oxoacid-CoA transferase 2A, EC 2.8.3, EC 2.8.3.5, FKSG25, FLJ00030, SCmitochondrial, SCOT-t, testis-specific succinyl CoA:3-oxoacid CoA-transferase

Gene Symbol

OXCT2

Additional SCOT2 Products

Product Documents for SCOT2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCOT2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SCOT2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SCOT2 Antibody - Azide and BSA Free and earn rewards!

Have you used SCOT2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...