SELENBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54805

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the N terminal of SELENBP1. Peptide sequence MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SELENBP1 Antibody - BSA Free

Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry: SELENBP1 Antibody [NBP1-54805]

Immunohistochemistry: SELENBP1 Antibody [NBP1-54805]

Immunohistochemistry: SELENBP1 Antibody [NBP1-54805] - Human Adult heart Observed Staining: Cytoplasmic,Membrane (weak) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.
Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.
Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805]

Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805]

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805]

Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805] - SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x. Image from verfied customer review.
SELENBP1 Antibody - BSA Free

Immunohistochemistry: SELENBP1 Antibody - BSA Free [NBP1-54805] -

Differences in protein expression of four hub genes. (a) Western blot analysis was performed to quantify the protein expression of SELENBP1, HOXB7, SPC24, and CDK1 in the LSCC and NT groups. (b) Protein levels were normalized to beta -actin. Quantification of protein levels such as those in (a) is shown in (b). (c) Representative immunostaining of SELENBP1, SPC24, HOXB7, and CDK1 in LSCC and NT groups. All magnification 400x. Each data was presented as mean +/- SEM (n ≥ 6/group). ∗∗∗∗P < 0.0001 versus the NT group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36718148), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SELENBP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
Paraffin data from customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-54805 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SELENBP1

SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. This gene product belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. The exact function of this gene is not known.

Alternate Names

56 kDa selenium-binding protein, hSBP, hSP56, LPSB, SBP, SBP56, selenium binding protein 1, selenium-binding protein 1, SP56FLJ13813

Gene Symbol

SELENBP1

UniProt

Additional SELENBP1 Products

Product Documents for SELENBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SELENBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SELENBP1 Antibody - BSA Free

Customer Reviews for SELENBP1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SELENBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Mouse Colon
    Species: Mouse
    Verified Customer | Posted 05/16/2014
    SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x
    SELENBP1 Antibody - BSA Free NBP1-54805

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...