SELENBP1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-54805
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the N terminal of SELENBP1. Peptide sequence MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SELENBP1 Antibody - BSA Free
Western Blot: SELENBP1 Antibody [NBP1-54805]
Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human heart.Immunohistochemistry: SELENBP1 Antibody [NBP1-54805]
Immunohistochemistry: SELENBP1 Antibody [NBP1-54805] - Human Adult heart Observed Staining: Cytoplasmic,Membrane (weak) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.Western Blot: SELENBP1 Antibody [NBP1-54805]
Western Blot: SELENBP1 Antibody [NBP1-54805] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.Western Blot: SELENBP1 Antibody [NBP1-54805]
Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human liver.Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805]
Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805] - SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x. Image from verfied customer review.Immunohistochemistry: SELENBP1 Antibody - BSA Free [NBP1-54805] -
Differences in protein expression of four hub genes. (a) Western blot analysis was performed to quantify the protein expression of SELENBP1, HOXB7, SPC24, and CDK1 in the LSCC and NT groups. (b) Protein levels were normalized to beta -actin. Quantification of protein levels such as those in (a) is shown in (b). (c) Representative immunostaining of SELENBP1, SPC24, HOXB7, and CDK1 in LSCC and NT groups. All magnification 400x. Each data was presented as mean +/- SEM (n ≥ 6/group). ∗∗∗∗P < 0.0001 versus the NT group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36718148), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SELENBP1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1.0 ug/ml
Application Notes
Paraffin data from customer review.
Reviewed Applications
Read 1 review rated 4 using NBP1-54805 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SELENBP1
Alternate Names
56 kDa selenium-binding protein, hSBP, hSP56, LPSB, SBP, SBP56, selenium binding protein 1, selenium-binding protein 1, SP56FLJ13813
Gene Symbol
SELENBP1
UniProt
Additional SELENBP1 Products
Product Documents for SELENBP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SELENBP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SELENBP1 Antibody - BSA Free
Customer Reviews for SELENBP1 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used SELENBP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Mouse ColonSpecies: MouseVerified Customer | Posted 05/16/2014SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...