The Semaphorins make up the largest family of axon guidance cues yet described. Semaphorins are divided into 8 classes (classes 3-7 found in vertebrates). Class 3 Semaphorins are secreted, classes 4 through 6 are transmembrane proteins, and class 7 are membrane associated via glycosylphosphatidylinositol (GPI) linkage. They are characterized structurally by a conserved ~400 amino acid sema domain. They are classically described as collapsing factors and mediators of axon repulsion, although they may also act as context-dependent chemoattractants. Semaphorins have been shown to have roles in cardiovascular development and in the regulation of immune cell antigen presentation. Receptors or receptor complexes that mediate semaphorin signaling include proteins of the Neuropilin and Plexin families.
Semaphorin 3F Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91480
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the N terminal of human Sema3f. Peptide sequence FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Semaphorin 3F Antibody - BSA Free
Western Blot: Semaphorin 3F Antibody [NBP1-91480]
Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Positive control: Lane1 : No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane3: AP-alone, Lane4: The cell media from cells transfected with AP-Sema3F Primary, Antibody Dilution: 1 ug/ml Secondary Antibody: Anti-AP Secondry, Antibody Dilution: 1 : 1000.Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]
Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480] - Researcher: Dr. Chrisna LeVaillant, School of Anatomy and Human BiologyApplication: IPSpecies+tissue/cell type: 1. 5mL conditioned media from HEK293F cells transfected with 1 : Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP.Western Blot: Semaphorin 3F Antibody [NBP1-91480]
Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]
Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480] - Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution: 1 : 500 Color/Signal Descriptions: Gene name: SEMA3F.Applications for Semaphorin 3F Antibody - BSA Free
Application
Recommended Usage
Immunoprecipitation
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Semaphorin 3F
Additional Semaphorin 3F Products
Product Documents for Semaphorin 3F Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Semaphorin 3F Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Semaphorin 3F Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Semaphorin 3F Antibody - BSA Free and earn rewards!
Have you used Semaphorin 3F Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...