Semenogelin I Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58013

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SEMG1(semenogelin I) The peptide sequence was selected from the N terminal of SEMG1 (NP_002998). Peptide sequence QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Semenogelin I Antibody - BSA Free

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013]

Western Blot: Semenogelin I Antibody [NBP1-58013] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013]

Immunohistochemistry: Semenogelin I Antibody [NBP1-58013] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Applications for Semenogelin I Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Semenogelin I

SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

CT103, dJ172H20.2, FLJ78262, semen coagulating protein, semenogelin IMGC14719, semenogelin-1, SEMGcancer/testis antigen 103, SGI

Entrez Gene IDs

6406 (Human)

Gene Symbol

SEMG1

UniProt

Additional Semenogelin I Products

Product Documents for Semenogelin I Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Semenogelin I Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Semenogelin I Antibody - BSA Free

Customer Reviews for Semenogelin I Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Semenogelin I Antibody - BSA Free and earn rewards!

Have you used Semenogelin I Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...