Septin-8 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93880

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 348-427 of human Septin-8 (NP_001287728.1). NKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-8 Antibody - Azide and BSA Free

Western Blot: Septin-8 AntibodyAzide and BSA Free [NBP2-93880]

Western Blot: Septin-8 AntibodyAzide and BSA Free [NBP2-93880]

Western Blot: Septin-8 Antibody [NBP2-93880] - Analysis of extracts of various cell lines, using Septin-8 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunocytochemistry/Immunofluorescence: Septin-8 Antibody [NBP2-93880] - Immunofluorescence analysis of C6 cells using Septin-8 antibody (NBP2-93880) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunohistochemistry-Paraffin: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunohistochemistry-Paraffin: Septin-8 Antibody [NBP2-93880] - Immunohistochemistry of paraffin-embedded Human thyroid cancer using Septin-8 Rabbit pAb (NBP2-93880) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [NBP2-93880]

Immunocytochemistry/Immunofluorescence: Septin-8 Antibody [NBP2-93880] - Analysis of L929 cells using Septin-8 at dilution of 1:100. Blue: DAPI for nuclear staining.
Septin-8 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [Septin-8] -

Immunocytochemistry/ Immunofluorescence: Septin-8 Antibody - Azide and BSA Free [Septin-8] - Immunofluorescence analysis of U-2 OS cells using Septin-8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Septin-8 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Septin-8

SEPT8 is a member of the highly conserved septin family. Septins are 40- to 60-kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking (Blaser et al., 2003 (PubMed 12909369)).(supplied by OMIM)

Alternate Names

KIAA0202SEP2, septin 8, septin-8

Gene Symbol

SEPTIN8

Additional Septin-8 Products

Product Documents for Septin-8 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Septin-8 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Septin-8 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Septin-8 Antibody - Azide and BSA Free and earn rewards!

Have you used Septin-8 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...