SerpinB9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33924

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SerpinB9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SerpinB9 Antibody [NBP2-33924]

Immunocytochemistry/ Immunofluorescence: SerpinB9 Antibody [NBP2-33924]

Immunocytochemistry/Immunofluorescence: SerpinB9 Antibody [NBP2-33924] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol.
SerpinB9 Antibody - BSA Free Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
SerpinB9 Antibody - BSA Free Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
SerpinB9 Antibody - BSA Free Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Staining of human kidney shows weak cytoplasmic positivity in cells in glomeruli.
SerpinB9 Antibody - BSA Free Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Applications for SerpinB9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SerpinB9

SerpinB9 is a serine proteinase inhibitor of the ovalbumin like B clade of serpins. The mouse orthologue to PI9 is SPI-6. SerpinB9 was first discovered in human bone marrow in a search for serpins similar to SerpinB6. SerpinB9 was identified in lymphocytes, especially natural killer cells and cytotoxic T lymphocytes, cells which also produce and store the apoptosis-inducing enzyme Granzyme B. PI9 was shown to be a potent inhibitor of Granzyme B, working at picamolar efficiencies. PI9 was also shown to inhibit caspase 1, the interleukin 1 converting enzyme, thus blocking IL1 223; production, and decreasing inflammatory processes. Most leukemia cells and many tumor cells produce PI9, leading to speculation that PI9 may help protect tumor cells from destruction by NK and CTL cells. PI9 is also found in placenta, lung, kidney, mast cells, and many tissues and cell lines. In kidney transplant, PI9 is sharply elevated, and in the liver PI9 has been shown to be upregulated by a downstream estrogen promoter. SerpinB9 inhibits Granzyme B, and is cleaved by Granzyme M, as a down regulatory step. SerpinB9 also inhibits the bacterial proteinase subtilisin A, and this may be a protective agent against infections. Neutrophil elastase is also a target of SerpinB9. Like SerpinB6 and SerpinB8, SerpinB9 lacks a signal sequence, and is found mainly in the cytoplasm and nucleus, although it can be detected outside of cells and in serum. The original SerpinB9 sequence described was 379 amino acids in length, with predicted mass of 42.4 kDa and pI of 5.51.

Alternate Names

CAP-3, CAP3PI-9, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI9protease inhibitor 9 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9, serpin B9, serpin peptidase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibitor, clade B, member 9

Gene Symbol

SERPINB9

UniProt

Additional SerpinB9 Products

Product Documents for SerpinB9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SerpinB9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SerpinB9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SerpinB9 Antibody - BSA Free and earn rewards!

Have you used SerpinB9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...