SET Antibody (8E8M9)

Novus Biologicals | Catalog # NBP3-16775

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8E8M9 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human SET (Q01105). ESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SET Antibody (8E8M9)

Western Blot: SET Antibody (8E8M9) [NBP3-16775]

Western Blot: SET Antibody (8E8M9) [NBP3-16775]

Western Blot: SET Antibody (8E8M9) [NBP3-16775] - Western blot analysis of extracts of various cell lines, using SET Rabbit mAb (NBP3-16775) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded mouse spleen using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded rat brain using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775]

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded human esophageal cancer using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation: SET Antibody (8E8M9) [NBP3-16775]

Immunoprecipitation: SET Antibody (8E8M9) [NBP3-16775]

Immunoprecipitation: SET Antibody (8E8M9) [NBP3-16775] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug SET antibody (NBP3-16775). Western blot was performed from the immunoprecipitate using SET antibody (NBP3-16775) at a dilition of 1:1000.
SET Antibody (8E8M9)

Immunocytochemistry/ Immunofluorescence: SET Antibody (8E8M9) [NBP3-16775] -

Immunocytochemistry/ Immunofluorescence: SET Antibody (8E8M9) [NBP3-16775] - Immunofluorescence analysis of U-2 OS cells using SET Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SET Antibody (8E8M9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SET

SET is a multi-functional protein involved in apoptosis, transcription, nucleosome assembly, and histone binding. SET was identified as part of a chromosomal rearrangement with NUP214/CAN in acute undifferentiated leukemia.

Alternate Names

2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor

Gene Symbol

SET

Additional SET Products

Product Documents for SET Antibody (8E8M9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SET Antibody (8E8M9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SET Antibody (8E8M9)

There are currently no reviews for this product. Be the first to review SET Antibody (8E8M9) and earn rewards!

Have you used SET Antibody (8E8M9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...