SFRS5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92381

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SFRS5 Antibody - BSA Free

Western Blot: SFRS5 Antibody [NBP1-92381]

Western Blot: SFRS5 Antibody [NBP1-92381]

Western Blot: SFRS5 Antibody [NBP1-92381] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: SFRS5 Antibody [NBP1-92381]

Immunocytochemistry/ Immunofluorescence: SFRS5 Antibody [NBP1-92381]

Immunocytochemistry/Immunofluorescence: SFRS5 Antibody [NBP1-92381] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381]

Immunohistochemistry-Paraffin: SFRS5 Antibody [NBP1-92381] - Staining of human pancreas shows weak nuclear positivity in exocrine glandular cells.
SFRS5 Antibody - BSA Free Western Blot: SFRS5 Antibody - BSA Free [NBP1-92381]

Western Blot: SFRS5 Antibody - BSA Free [NBP1-92381]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for SFRS5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS5

SFRS5 plays a role in constitutive splicing and can modulate the selection of alternative splice sites

Alternate Names

Delayed-early protein HRS, HRSSFRS5, serine/arginine-rich splicing factor 5, Splicing factor, arginine/serine-rich 5Pre-mRNA-splicing factor SRP40, SRP40SR splicing factor 5

Gene Symbol

SRSF5

Additional SFRS5 Products

Product Documents for SFRS5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFRS5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS5 Antibody - BSA Free and earn rewards!

Have you used SFRS5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...