SFRS7 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94049

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854). AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SFRS7 Antibody - Azide and BSA Free

Western Blot: SFRS7 AntibodyAzide and BSA Free [NBP2-94049]

Western Blot: SFRS7 AntibodyAzide and BSA Free [NBP2-94049]

Western Blot: SFRS7 Antibody [NBP2-94049] - Western blot analysis of extracts of various cell lines, using SFRS7 Rabbit pAb (NBP2-94049) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: SFRS7 Antibody - Azide and BSA Free [NBP2-94049]

Immunocytochemistry/ Immunofluorescence: SFRS7 Antibody - Azide and BSA Free [NBP2-94049]

Immunocytochemistry/Immunofluorescence: SFRS7 Antibody [NBP2-94049] - Analysis of U-2 OS cells using SFRS7 at dilution of 1:100. Blue: DAPI for nuclear staining.
SFRS7 Antibody - Azide and BSA Free

Immunohistochemistry: SFRS7 Antibody - Azide and BSA Free [SFRS7] -

Immunohistochemistry: SFRS7 Antibody - Azide and BSA Free [SFRS7] - Immunohistochemistry analysis of paraffin-embedded Mouse spinal cord using SFRS7 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
SFRS7 Antibody - Azide and BSA Free

Immunohistochemistry: SFRS7 Antibody - Azide and BSA Free [SFRS7] -

Immunohistochemistry: SFRS7 Antibody - Azide and BSA Free [SFRS7] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using SFRS7 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for SFRS7 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SFRS7

SFRS7 is required for pre-mRNA splicing. Can also modulate alternative splicing in vitro

Alternate Names

AAG3, aging-associated protein 3, arginine/serine-rich 7, 35kDa, HSSG1, RBM37, serine/arginine-rich splicing factor 7, SFRS7ZCRB2,9G8, Splicing factor 9G8, Splicing factor, arginine/serine-rich 7, splicing factor, arginine/serine-rich 7 (35kD), SR splicing factor 7, ZCCHC20

Gene Symbol

SRSF7

Additional SFRS7 Products

Product Documents for SFRS7 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFRS7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SFRS7 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SFRS7 Antibody - Azide and BSA Free and earn rewards!

Have you used SFRS7 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...