SFXN2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85960
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQ
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SFXN2 Antibody - BSA Free
Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Staining of human stomach shows strong cytoplasmic positivity in glandular cells.Staining of human placenta shows moderate positivity in trophoblastic cells.
Staining of human placenta shows moderate positivity in trophoblastic cells.Immunohistochemistry-Paraffin: SFXN2 Antibody - BSA Free [NBP1-85960]
Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960]
Analysis in control (vector only transfected HEK293T lysate) and SFXN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Parkin mediates SFXN2 degradation through K48-linked polyubiquitination (A,B) Western blot (WB) analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K48, HA-Ub-K48R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the immunoblotting (IB, A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K63, HA-Ub-K63R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the IB (C), Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Parkin negatively regulates SFXN2 protein levels in cells (A,B) Western blot (WB) analysis of SFXN2 and Parkin protein levels in HEK293 cells transfected with scrambled siRNA or siRNA targeting Parkin (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing Parkin-Myc or control vector (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of endogenous SFXN2 and Parkin protein levels in HEK293 cells overexpressing control vector or Parkin-Myc (E), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (F). (G,H) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells overexpressing SFXN2-HA alone or Parkin-Myc plus SFXN2-HA (G), with or without 10 μM MG132 treatment for 8 h before harvest. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (H). (I,J) WB analysis of SFXN2 and Parkin protein levels in HEK293 cells expressing SFXN2-HA and Parkin variant (control vector, Parkin-WT, Pakin-T240R, or Parkin-R42P). Anti-alpha -Tubulin was used as the loading control for the IB. Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (J). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA and two-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Mitochondrial impairment decreases SFXN2 levels (A,B) Western blot (WB) analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with 20 μM CCCP for the indicated time periods (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Cytochrome C (Cyt C) protein levels in HEK293 cells treated with the indicated concentrations of MPP+ for 24 h (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with vehicle control (0.05% (v/v) DMSO), CCCP (10 μM) alone, or CCCP (10 μM) combined with MG132 (10 μM) for 12 h (E). Quantification of relative SFXN2 protein levels normalized to actin is presented in the histogram (F). Images are representative of at least three independent experiments with similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Mitochondrial impairment decreases SFXN2 levels (A,B) Western blot (WB) analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with 20 μM CCCP for the indicated time periods (A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2 and Cytochrome C (Cyt C) protein levels in HEK293 cells treated with the indicated concentrations of MPP+ for 24 h (C). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). (E,F) WB analysis of SFXN2 and PINK1 protein levels in HEK293 cells treated with vehicle control (0.05% (v/v) DMSO), CCCP (10 μM) alone, or CCCP (10 μM) combined with MG132 (10 μM) for 12 h (E). Quantification of relative SFXN2 protein levels normalized to actin is presented in the histogram (F). Images are representative of at least three independent experiments with similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one-way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SFXN2 Antibody - BSA Free [NBP1-85960] -
Parkin mediates SFXN2 degradation through K48-linked polyubiquitination (A,B) Western blot (WB) analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K48, HA-Ub-K48R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the immunoblotting (IB, A). Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (B). (C,D) WB analysis of SFXN2, Parkin, and Ubiquitin protein levels in HEK293 cells expressing Parkin-Myc, SFXN2-HA, and Ubiquitin variant (control vector, HA-Ub-WT, HA-Ub-K63, HA-Ub-K63R, or HA-Ub-KR). Anti-alpha -Tubulin was used as the loading control for the IB (C), Quantification of relative SFXN2 protein levels normalized to alpha -Tubulin is presented in the histogram (D). Images are representative of at least three independent experiments that gave similar results. Histogram data are presented as mean +/- SEM (N = 3). Statistical significance was analyzed using one way ANOVA. *p < 0.05, **p < 0.01, ***p < 0.001, ns, non-significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40894005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Staining of human cell line U-2 OS shows localization to mitochondria.Applications for SFXN2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SFXN2
Alternate Names
sideroflexin 2, sideroflexin-2
Gene Symbol
SFXN2
Additional SFXN2 Products
Product Documents for SFXN2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SFXN2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SFXN2 Antibody - BSA Free
Customer Reviews for SFXN2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SFXN2 Antibody - BSA Free and earn rewards!
Have you used SFXN2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...