SLC10A7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86784

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC10A7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC10A7 Antibody - BSA Free

SLC10A7 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.
SLC10A7 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.
SLC10A7 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Staining of human upper Small intestine shows strong granular cytoplasmic positivity in glandular cells.
SLC10A7 Antibody - BSA Free Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Immunohistochemistry-Paraffin: SLC10A7 Antibody - BSA Free [NBP1-86784]

Staining of human Skeletal muscle shows strong cytoplasmic positivity in myocytes.

Applications for SLC10A7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC10A7

DKFZP566M114( AAH63471, 1 a.a. - 160 a.a.) full-length recombinant protein with GST.

Alternate Names

C4orf13, chromosome 4 open reading frame 13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043, Na(+)/bile acid cotransporter 7, P7, SBF-domain containing protein, sodium/bile acid cotransporter 7, solute carrier family 10 (sodium/bile acid cotransporter family), member 7, Solute carrier family 10 member 7

Gene Symbol

SLC10A7

Additional SLC10A7 Products

Product Documents for SLC10A7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC10A7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC10A7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC10A7 Antibody - BSA Free and earn rewards!

Have you used SLC10A7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies