SLC38A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88872

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC38A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human kidney shows moderate cytoplasmic granular positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
SLC38A2 Antibody

Immunohistochemistry: Rabbit Polyclonal SLC38A2 Antibody [NBP1-88872]

Immunohistochemistry: Rabbit Polyclonal SLC38A2 Antibody [NBP1-88872] - SLC38A2 expression is detected only in mitotic spermatogonia and not in meiotic spermatocytes. Sections were treated with xylene for deparaffinization and ethanol for rehydration. Antigen retrieval was achieved by microwaving in 10 mM citrate-based buffer at pH 6.0. Sections were washed by PBS with 0.05% Tween 20, followed by incubation with SLC38A2 antibodies overnight at 4°C and secondary antibodies at room temperature for 1 h. Image from a verified customer review.

Applications for SLC38A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-88872 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A2

SLC38A2 functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain b

Alternate Names

Amino acid transporter A2, ata2, ATA2System A transporter 1, KIAA1382System N amino acid transporter 2, pro1068, Protein 40-9-1, sat2, SAT2PRO1068, snat2, SNAT2amino acid transporter 2, sodium-coupled neutral amino acid transporter 2, Solute carrier family 38 member 2, solute carrier family 38, member 2, System A amino acid transporter 2

Gene Symbol

SLC38A2

Additional SLC38A2 Products

Product Documents for SLC38A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC38A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC38A2 Antibody - BSA Free

Customer Reviews for SLC38A2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SLC38A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • SLC38A2 staining
    Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Testis tissue
    Species: Human
    Verified Customer | Posted 02/17/2025
    SLC38A2 expression is detected only in mitotic spermatogonia and not in meiotic spermatocytes.
    Sections were treated with xylene for deparaffinization and ethanol for rehydration. Antigen retrieval was achieved by microwaving in 10 mM citrate-based buffer at pH 6.0. Sections were washed by PBS with 0.05% Tween 20, followed by incubation with SLC38A2 antibodies overnight at 4°C and secondary antibodies at room temperature for 1 h.
    SLC38A2 Antibody - BSA Free NBP1-88872

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...