SLC39A8/ZIP8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34058

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC39A8/ZIP8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC39A8/ZIP8 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human salivary gland shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows distinct membranous positivity in syncytiotrophoblasts.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human pancreas shows negative membranous positivity in islets of Langerhans and moderate membranous positivity in exocrien pancreas.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058]

Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP2-34058] - Staining of human rectum shows moderate membranous positivity in glandular cells.

Applications for SLC39A8/ZIP8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC39A8/ZIP8

The SLC39A8 gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import

Alternate Names

BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8

Gene Symbol

SLC39A8

UniProt

Q9C0K1 (Human)

Additional SLC39A8/ZIP8 Products

Product Documents for SLC39A8/ZIP8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC39A8/ZIP8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A8/ZIP8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A8/ZIP8 Antibody - BSA Free and earn rewards!

Have you used SLC39A8/ZIP8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies