SLC4A4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-17023
![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]](https://resources.rndsystems.com/images/products/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP3-17023-img0002.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SLC4A4 Antibody - BSA Free
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023] - Staining of human kidney shows high expression.![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]](https://resources.rndsystems.com/images/products/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP3-17023-img0001.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]")
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023] - Analysis in human kidney and testis tissues using Anti-SLC4A4 antibody. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]](https://resources.rndsystems.com/images/products/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP3-17023-img0003.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]")
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023]
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP3-17023] - Staining of human testis shows low expression as expected.Applications for SLC4A4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC4A4
Alternate Names
electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5
Gene Symbol
SLC4A4
Additional SLC4A4 Products
Product Documents for SLC4A4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC4A4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC4A4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC4A4 Antibody - BSA Free and earn rewards!
Have you used SLC4A4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for SLC4A4 Antibody - BSA Free
Showing
1
-
1 的
1 FAQ
Showing All
-
Q: Have any of your SLC4A4 antibodies been tested for use in IHC?
A: The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our Innovators Reward Program. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.
Loading...