SLC7A9 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93638

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SLC7A9 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SLC7A9 Antibody - Azide and BSA Free (NBP2-93638) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SLC7A9 Antibody - Azide and BSA Free

Western Blot: SLC7A9 AntibodyAzide and BSA Free [NBP2-93638]

Western Blot: SLC7A9 AntibodyAzide and BSA Free [NBP2-93638]

Western Blot: SLC7A9 Antibody [NBP2-93638] - Analysis of extracts of various cell lines, using SLC7A9 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.
Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of rat kidney using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody - Azide and BSA Free [NBP2-93638]

Immunohistochemistry: SLC7A9 Antibody [NBP2-93638] - Analysis of human kidney cancer using SLC7A9 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for SLC7A9 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC7A9

The SLC7A9 gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in t

Long Name

Solute Carrier Family 7 Member 9

Alternate Names

b(0,+)AT, BAT1, CSNU3

Gene Symbol

SLC7A9

Additional SLC7A9 Products

Product Documents for SLC7A9 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC7A9 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SLC7A9 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC7A9 Antibody - Azide and BSA Free and earn rewards!

Have you used SLC7A9 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies