SLCO1A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85770

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2. Peptide sequence: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLCO1A2 Antibody - BSA Free

Western Blot: SLCO1A2 Antibody [NBP2-85770]

Western Blot: SLCO1A2 Antibody [NBP2-85770]

Western Blot: SLCO1A2 Antibody [NBP2-85770] - WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateSLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells
Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770]

Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770]

Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770] - Rabbit Anti-SLCO1A2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane, Cytoplasm in hepatocytes, very strong, moderate tissue distribution. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 -2.0 sec.
Western Blot: SLCO1A2 Antibody [NBP2-85770]

Western Blot: SLCO1A2 Antibody [NBP2-85770]

Western Blot: SLCO1A2 Antibody [NBP2-85770] - Host: Rabbit. Target Name: SLCO1A2. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for SLCO1A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLCO1A2

The SLCO1A2 gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute c

Alternate Names

OATP1, OATP1A2member 3, OATP-AOATP-1, OATPSolute carrier family 21 member 3, Organic anion-transporting polypeptide 1, Sodium-independent organic anion transporter, solute carrier organic anion transporter family member 1A2, solute carrier organic anion transporter family, member 1A2

Gene Symbol

SLCO1A2

Additional SLCO1A2 Products

Product Documents for SLCO1A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLCO1A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLCO1A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLCO1A2 Antibody - BSA Free and earn rewards!

Have you used SLCO1A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...