Slug Antibody (3C12) - Azide and BSA Free
Novus Biologicals | Catalog # H00006591-M05
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG3 Kappa Clone # 3C12
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Specificity
SNAI2 (3C12)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG3 Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for Slug Antibody (3C12) - Azide and BSA Free
Western Blot: Slug Antibody (3C12) [H00006591-M05]
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in NIH/3T3 (Cat # L018V1).Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]
Immunocytochemistry/Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on U-2 OS cell. Antibody concentration 10 ug/mlWestern Blot: Slug Antibody (3C12) [H00006591-M05]
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in PC-12 (Cat # L012V1).Western Blot: Slug Antibody (3C12) [H00006591-M05]
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in HepG2 (Cat # L019V1).Western Blot: Slug Antibody (3C12) [H00006591-M05]
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in Raw 264.7 (Cat # L024V1).Western Blot: Slug Antibody (3C12) [H00006591-M05]
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in human liver.Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05]
Immunocytochemistry/Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on HepG2 cell. Antibody concentration 10 ug/mlApplications for Slug Antibody (3C12) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IF and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Slug
Alternate Names
SLUGH1, SNAI2, SNAIL2, WS2D
Entrez Gene IDs
6591 (Human)
Gene Symbol
SNAI2
OMIM
602150 (Human)
UniProt
Additional Slug Products
Product Documents for Slug Antibody (3C12) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Slug Antibody (3C12) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Slug Antibody (3C12) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Slug Antibody (3C12) - Azide and BSA Free and earn rewards!
Have you used Slug Antibody (3C12) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...