SQLE Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93808

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SQLE (NP_003120.2). VSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SQLE Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: SQLE Antibody - Azide and BSA Free [NBP2-93808]

Immunocytochemistry/ Immunofluorescence: SQLE Antibody - Azide and BSA Free [NBP2-93808]

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] - Analysis of NIH-3T3 cells using SQLE. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: SQLE Antibody - Azide and BSA Free [NBP2-93808]

Immunocytochemistry/ Immunofluorescence: SQLE Antibody - Azide and BSA Free [NBP2-93808]

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] - Analysis of HeLa cells using SQLE. Blue: DAPI for nuclear staining.
SQLE Antibody

Western Blot: SQLE Antibody [NBP2-93808] -

Western Blot: SQLE Antibody [NBP2-93808] - Analysis of HepG2, using SQLE antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
SQLE Antibody

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] -

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] -Analysis of HepG2 cells using SQLE Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
SQLE Antibody

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] -

Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP2-93808] -Analysis of PC-12 cells using SQLE Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Applications for SQLE Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50-1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SQLE

Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. [provided by RefSeq]

Alternate Names

EC 1.14.99.7, ERG1, FLJ30795, squalene epoxidaseSE, squalene monooxygenase

Gene Symbol

SQLE

Additional SQLE Products

Product Documents for SQLE Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SQLE Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SQLE Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SQLE Antibody - Azide and BSA Free and earn rewards!

Have you used SQLE Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...