Stathmin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93761

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Stathmin 1 (NP_005554.1). MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Stathmin 1 Antibody - BSA Free

Western Blot: Stathmin 1 AntibodyAzide and BSA Free [NBP2-93761]

Western Blot: Stathmin 1 AntibodyAzide and BSA Free [NBP2-93761]

Western Blot: Stathmin 1 Antibody [NBP2-93761] - Analysis of extracts of various cell lines, using Stathmin 1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Stathmin 1 Antibody - Azide and BSA Free [NBP2-93761]

Immunohistochemistry-Paraffin: Stathmin 1 Antibody - Azide and BSA Free [NBP2-93761]

Immunohistochemistry-Paraffin: Stathmin 1 Antibody [NBP2-93761] - Paraffin-embedded rat brain using Stathmin 1.

Applications for Stathmin 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Stathmin/STMN1

Stathmin (oncoprotein 18, op18) is a ubiquitous cytosolic phosphoprotein with various regulatory functions in cell proliferation, differentiation signaling, and activation (1). In particular, stathmin is involved in the regulation of tubulin dynamics through inhibition of microtubule formation and/or microtubule depolymerization. Stathmin interacts with soulable tubulins (alpha,beta-tubulin) resulting in the formation of T2S complex which sequesters free tubulin, impeding tubulin formation (2). Stathmin activity is regulated through phosphorylation at Ser16, Ser25, Ser38 and Ser63 by various protein kinases (e.g. MAP-kinase, p34cdc2 kinase), weakening stathmin's affinity to tubulin (3). A mutation on stathmin can lead to excess build up of mitotic spindle and with possible consequence of unregulated cell cycles seen in cancer cells (4). Stathmin is also known as the generic member of a protein family which includes neural proteins SCG10, SCLIP and RB3/RB3/RB3. All members in this family exhibits tubulin binding ability.

Alternate Names

LAP18, Metablastin, OP18, Phosphoprotein p19, Prosolin, SMN, STMN1

Gene Symbol

STMN1

Additional Stathmin/STMN1 Products

Product Documents for Stathmin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Stathmin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Customer Reviews for Stathmin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Stathmin 1 Antibody - BSA Free and earn rewards!

Have you used Stathmin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...