STI1 Antibody (4S8L6)
Novus Biologicals | Catalog # NBP3-15246
Recombinant Monoclonal Antibody
![Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]](https://beta-resources.rndsystems.com/images/products/STI1-Antibody-4S8L6-Western-Blot-NBP3-15246-img0004.jpg "Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4S8L6 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STI1 (P31948). EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit STI1 Antibody (4S8L6) (NBP3-15246) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for STI1 Antibody (4S8L6)
Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]
Western Blot: STI1 Antibody (4S8L6) [NBP3-15246] - Western blot analysis of extracts of various cell lines, using STI1 Rabbit mAb (NBP3-15246) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]](https://beta-resources.rndsystems.com/images/products/STI1-Antibody-4S8L6-Immunohistochemistry-Paraffin-NBP3-15246-img0003.jpg "Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]")
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246] - Immunohistochemistry of paraffin-embedded mouse testis using STI1 Rabbit mAb (NBP3-15246) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.![Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]](https://beta-resources.rndsystems.com/images/products/STI1-Antibody-4S8L6-Western-Blot-NBP3-15246-img0005.jpg "Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]")
Western Blot: STI1 Antibody (4S8L6) [NBP3-15246]
Western Blot: STI1 Antibody (4S8L6) [NBP3-15246] - Western blot analysis of extracts of various cell lines, using STI1 Rabbit mAb (NBP3-15246) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.![Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]](https://beta-resources.rndsystems.com/images/products/STI1-Antibody-4S8L6-Immunohistochemistry-Paraffin-NBP3-15246-img0001.jpg "Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]")
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246] - Immunohistochemistry of paraffin-embedded rat testis using STI1 Rabbit mAb (NBP3-15246) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]](https://beta-resources.rndsystems.com/images/products/STI1-Antibody-4S8L6-Immunohistochemistry-Paraffin-NBP3-15246-img0002.jpg "Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]")
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246]
Immunohistochemistry-Paraffin: STI1 Antibody (4S8L6) [NBP3-15246] - Immunohistochemistry of paraffin-embedded human esophageal cancer using STI1 Rabbit mAb (NBP3-15246) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Applications for STI1 Antibody (4S8L6)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: STI1
Long Name
Stress-induced Phosphoprotein 1
Alternate Names
HOP, IEF-SSP-3521, NY-REN-11, STI1L, STIP1
Gene Symbol
STIP1
Additional STI1 Products
Product Documents for STI1 Antibody (4S8L6)
Product Specific Notices for STI1 Antibody (4S8L6)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for STI1 Antibody (4S8L6)
There are currently no reviews for this product. Be the first to review STI1 Antibody (4S8L6) and earn rewards!
Have you used STI1 Antibody (4S8L6)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...