SUMO-interacting Motif (SIM) Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55180

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SUMO-interacting Motif (SIM) Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-55180]

Immunocytochemistry/ Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-55180]

Immunocytochemistry/Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-55180] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-55180]

Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-55180]

Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-55180] - Staining of human bronchus shows strong cytoplasmic, nucleolar and membranous positivity in respiratory epithelial cells.

Applications for SUMO-interacting Motif (SIM) Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SUMO-interacting Motif (SIM)

Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that are enzymatically attached to target proteins by a process termed SUMOylation. This post-translational modification regulates many cellular processes including DNA transcription and repair, cell cycle progression, protein intracellular trafficking, and nuclear receptor activities. SUMO binding and/or interaction with proteins is mediated by short amino acid consensus sequences termed SUMO-interacting motifs (SIMs). To date, all SIMs appear to contain a hydrophobic core sequence that is either preceded or succeeded by an acidic region composed of either glutamate or aspartate residues or phosphorylated serine or threonine residues. The hydrophobic core of SIMs has been shown to interact with the alpha-helix and beta2-strand surfaces on SUMO proteins while the negatively charged residues surrounding the hydrophobic core appear to influence binding affinities and dictate binding preferences for the various SUMO isoforms. SIMs have been identified in numerous types of proteins including SUMO ligases (E3), transcription factors, and transcriptional repressors.

Alternate Names

SUMOinteracting Motif

Gene Symbol

SIMC1

Additional SUMO-interacting Motif (SIM) Products

Product Documents for SUMO-interacting Motif (SIM) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUMO-interacting Motif (SIM) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUMO-interacting Motif (SIM) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUMO-interacting Motif (SIM) Antibody - BSA Free and earn rewards!

Have you used SUMO-interacting Motif (SIM) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...