TEAD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10510

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TEAD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD1 (NP_068780). Peptide sequence YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TEAD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510]

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510]

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

Applications for TEAD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TEAD1

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Long Name

Transcriptional enhancer factor TEF-1

Alternate Names

AA, NTEF-1, protein GT-IIC, REF1, TCF13, TCF-13, TEA domain family member 1 (SV40 transcriptional enhancer factor), TEAD1, TEAD-1, TEF-1, transcription factor 13, transcriptional enhancer factor 1, transcriptional enhancer factor TEF-1

Gene Symbol

TEAD1

Additional TEAD1 Products

Product Documents for TEAD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TEAD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TEAD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TEAD1 Antibody - BSA Free and earn rewards!

Have you used TEAD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies