THAP11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92495

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THAP11 Antibody - BSA Free

Western Blot: THAP11 Antibody [NBP1-92495]

Western Blot: THAP11 Antibody [NBP1-92495]

Western Blot: THAP11 Antibody [NBP1-92495] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: THAP11 Antibody [NBP1-92495]

Immunocytochemistry/ Immunofluorescence: THAP11 Antibody [NBP1-92495]

Immunocytochemistry/Immunofluorescence: THAP11 Antibody [NBP1-92495] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytokinetic bridge.
THAP11 Antibody - BSA Free Immunohistochemistry: THAP11 Antibody - BSA Free [NBP1-92495]

Immunohistochemistry: THAP11 Antibody - BSA Free [NBP1-92495]

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
THAP11 Antibody - BSA Free Western Blot: THAP11 Antibody - BSA Free [NBP1-92495]

Western Blot: THAP11 Antibody - BSA Free [NBP1-92495]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
THAP11 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: THAP11 Antibody - BSA Free [NBP1-92495]

Chromatin Immunoprecipitation-exo-Seq: THAP11 Antibody - BSA Free [NBP1-92495]

ChIP-Exo-Seq composite graph for Anti-THAP11 (NBP1-92495) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for THAP11 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THAP11

THAP11 is a member of the thanatos-associated proteins (THAP) family, which are zinc-dependent, sequence-specific DNA-binding factors involved in cell proliferation, apoptosis, cell cycle, chromatin modification, and transcriptional regulation (Zhu, et al). THAP11 has been hypothesized to be a cell growth inhibitor via the repression of c-myc (Zhu, et al), and THAP11 expression has also been linked to the proliferation of embryonic stem cells (Dejosez M et al).

Long Name

THAP Domain Containing 11

Alternate Names

CTG-B43a, CTG-B45d, Ronin

Gene Symbol

THAP11

Additional THAP11 Products

Product Documents for THAP11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THAP11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THAP11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THAP11 Antibody - BSA Free and earn rewards!

Have you used THAP11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...