THAP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81130

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THAP6 Antibody - BSA Free

Western Blot: THAP6 Antibody [NBP1-81130]

Western Blot: THAP6 Antibody [NBP1-81130]

Western Blot: THAP6 Antibody [NBP1-81130] - Analysis in control (vector only transfected HEK293T lysate) and THAP6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: THAP6 Antibody [NBP1-81130]

Immunohistochemistry-Paraffin: THAP6 Antibody [NBP1-81130]

Immunohistochemistry-Paraffin: THAP6 Antibody [NBP1-81130] - Staining of human nasopharynx shows moderate cytoplasmic positivity in respiratory epithelial cells.
THAP6 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: THAP6 Antibody - BSA Free [NBP1-81130]

Chromatin Immunoprecipitation-exo-Seq: THAP6 Antibody - BSA Free [NBP1-81130]

ChIP-Exo-Seq composite graph for Anti-THAP6 (NBP1-81130) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
THAP6 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: THAP6 Antibody [NBP1-81130]

Immunocytochemistry/ Immunofluorescence: THAP6 Antibody [NBP1-81130]

Staining of human cell line A-431 shows positivity in centrosome & nucleus but excluded from the nucleoli.

Applications for THAP6 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THAP6

Alternate Names

MGC30052, THAP domain containing 6, THAP domain-containing protein 6

Entrez Gene IDs

152815 (Human)

Gene Symbol

THAP6

Additional THAP6 Products

Product Documents for THAP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THAP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for THAP6 Antibody - BSA Free

Customer Reviews for THAP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THAP6 Antibody - BSA Free and earn rewards!

Have you used THAP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...