THEM6 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84052
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Chemotaxis
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%), Mouse (88%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for THEM6 Antibody - BSA Free
Western Blot: THEM6 Antibody [NBP1-84052]
Western Blot: THEM6 Antibody [NBP1-84052] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissueImmunocytochemistry/ Immunofluorescence: THEM6 Antibody [NBP1-84052]
Immunocytochemistry/Immunofluorescence: THEM6 Antibody [NBP1-84052] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052]
Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052] - Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052]
Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052]
Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052] - Staining of human Fallopian tube shows moderate to strong membranous positivity in glandular cells.Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052]
Immunohistochemistry-Paraffin: THEM6 Antibody [NBP1-84052] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunohistochemistry: THEM6 Antibody - BSA Free [NBP1-84052] -
Xiangya cohort validates the relationship between THEM6 and immune phenotypes. (a) Exome sequencing analysis on THEM6 mRNA levels in 12 paired bladder cancer and normal tissues. (b) QPCR estimation on three cancer cell lines (T24, J82, and 5637) and one normal cell line (SV-HUC-1). The asterisks indicate a significant statistical P value calculated using paired-samples t-test. (c) Expression of THEM6, PD-L1, and CD8 in the BLCA TMA cohort was detected using immunohistochemistry. Representative images of CD8, PD-L1, and THEM6 in three immune phenotypes were displayed. The scale bars correspond to 200 μm. (d) CD8-positive rates in the three immune phenotypes in the BLCA TMA cohort detected by IHC. (e) Correlation between PD-L1-positive rates and CD8-positive rates detected using IHC. (f, g) Correlation between THEM6-positive rates and CD8/PD-L1-positive rates detected using IHC, respectively. The asterisks indicate a significant statistical P value calculated using the Mann–Whitney U test (∗P < 0.05; ∗∗P < 0.01; ∗∗∗P < 0.001). (h) Correlations between THEM6 and the steps of the cancer immunity cycle. (i) Correlations between THEM6 and four critical marker genes of macrophages. (j) Correlations between THEM6 and 20 immune checkpoints. The color and the values indicate the Spearman correlation coefficient. IHC: immunohistochemistry. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35909893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for THEM6 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: THEM6
Alternate Names
C8orf55, chromosome 8 open reading frame 55, DSCD75, Mesenchymal stem cell protein DSCD75, thioesterase superfamily member 6
Gene Symbol
THEM6
Additional THEM6 Products
Product Documents for THEM6 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for THEM6 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for THEM6 Antibody - BSA Free
Customer Reviews for THEM6 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review THEM6 Antibody - BSA Free and earn rewards!
Have you used THEM6 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...