THSD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86930

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THSD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: THSD1 Antibody [NBP1-86930]

Immunocytochemistry/ Immunofluorescence: THSD1 Antibody [NBP1-86930]

Immunocytochemistry/Immunofluorescence: THSD1 Antibody [NBP1-86930] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930]

Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930]

Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
THSD1 Antibody - BSA Free Western Blot: THSD1 Antibody - BSA Free [NBP1-86930]

Western Blot: THSD1 Antibody - BSA Free [NBP1-86930]

Analysis in control (vector only transfected HEK293T lysate) and THSD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
THSD1 Antibody - BSA Free

Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -

THSD1 inactivation promotes autophagy in endothelial cells. (A) Representative images of GFP-LC3 puncta formation in control or THSD1-deficient HBMECs in the absence and presence of pepstatin (50 ug/mL)/E-64D (50 uM) treatment (abbreviated as P/E) for 6 h. Specifically, GFP-LC3 puncta formation in control cells without vs. with P/E treatment (A1 vs. A3) and THSD1-deficient cells without vs. with P/E treatment (A2 vs. A4). (B,C) Analysis of the effects of THSD1 inactivation on LC3 puncta formation (B) and autophagic flux (C) in control or THSD1-deficient cells. The number of LC3 puncta per cellular profile was quantified. (D) Western blot analysis of p62 protein levels in control or THSD1-deficient HBMECs, with quantification in (E). (F) Representative images of Western blots against ubiquitinated proteins using the FK1 antibody. GAPDH served as a loading control. (G) Fold changes were calculated after normalization to the total ubiquitinated protein level in the control sample (n = 3 independent experiments). * p < 0.05; ** p < 0.01. ns: not significant. Scale bar: 10 um. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
THSD1 Antibody - BSA Free

Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -

THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
THSD1 Antibody - BSA Free

Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -

THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
THSD1 Antibody - BSA Free

Western Blot: THSD1 Antibody - BSA Free [NBP1-86930] -

THSD1-mediated autophagy is independent of mTOR or AMPK pathway. (A–C) Western blot analysis of whole cell lysates (WCL) from control or THSD1-deficient HBMECs using antibodies against p-S6K-T389, S6K, p-4E-BP1-37/46, and 4E-BP1. GAPDH served as a loading control. Quantification of p-S6K-T389 (B) and p-4E-BP1-T37/46 (C) levels was analyzed by Student’s t-test (n = 3 independent experiments). (D–I) Representative Western blots of WCL from control or THSD1-deficient HBMECs for analyzing AMPK signaling (D–F) or ULK1 activation (G–I). Quantification of p-AMPK alpha -T172 (E), p-ACC-S79 (F), p-ULK1-S757, and p-ULK1-S555 was analyzed by Student’s t-test (n = 3 independent experiments). ns: not significant. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/1422-0067/25/4/2139), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for THSD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 28576485). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THSD1

Mouse THSD1 (Thrombospondin type-1 domain-containing protein 1), also known as Transmembrane molecule with thrombospondin module (Tmtsp), is a 95 kDa, type I transmembrane protein. It is synthesized as a precursor that is 851 amino acids (aa) in length, and has a 24 aa signal sequence, a 388 aa extracellular region, a 21 aa transmembrane region, and a 418 aa cytoplasmic region. The extracellular region contains six potential N-linked glycosylation sites and the thrombospondin type-1 (TSP1) domain, which is implicated in cell adhesion and migration. Also present in the molecule are 9 PKC-phosphorylation sites, 3 Ig-like domains, and a tyrosine-phosphorylation site by its C-terminus. Mouse THSD1 shares 78% aa sequence identity with human THSD1. THSD1 is highly expressed in hematopoietic stem cells (HSCs) and progenitor cells, including CD34-/lowKit+Sca-1+Lin- HSCs, CD34+Kit+Sca-1+Lin- and Lin- progenitor cells, and to a lesser degree in thymic CD4-CD8- cells. Expression gradually decreases during T cell differentiation. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand. THSD1 may function in primitive hematopoietic cells in the bone marrow niche, and through its TSP1 and Ig-like domains, it may play a role in HSC homing to the niche following cell-to-cell contact to maintain hematopoietic stem cell quiescence.

Long Name

Thrombospondin, Type I, Domain Containing 1

Alternate Names

TMTSP

Gene Symbol

THSD1

Additional THSD1 Products

Product Documents for THSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for THSD1 Antibody - BSA Free

Customer Reviews for THSD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THSD1 Antibody - BSA Free and earn rewards!

Have you used THSD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...