TIMM50 Antibody (0W6J4)

Novus Biologicals | Catalog # NBP3-15459

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0W6J4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIMM50 (Q3ZCQ8). MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIMM50 Antibody (0W6J4)

Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459]

Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459]

Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459] - Western blot analysis of extracts of various cell lines, using TIMM50 Rabbit mAb (NBP3-15459) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunocytochemistry/Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunofluorescence analysis of NIH-3T3 cells using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded mouse pancreas using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459]

Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459]

Western Blot: TIMM50 Antibody (0W6J4) [NBP3-15459] - Western blot analysis of extracts of various cell lines, using TIMM50 Rabbit mAb (NBP3-15459) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded rat kidney using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459]

Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded human liver using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
TIMM50 Antibody (0W6J4)

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] - Confocal imaging of NIH/3T3 cells using TIMM50 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
TIMM50 Antibody (0W6J4)

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry analysis of TIMM50 in paraffin-embedded rat kidney tissue using TIMM50 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
TIMM50 Antibody (0W6J4)

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry analysis of TIMM50 in paraffin-embedded human liver tissue using TIMM50 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
TIMM50 Antibody (0W6J4)

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] - Confocal imaging of paraffin-embedded Mouse kidney tissue using TIMM50 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
TIMM50 Antibody (0W6J4)

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody (0W6J4) [NBP3-15459] - Confocal imaging of paraffin-embedded Human kidney tissue using TIMM50 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
TIMM50 Antibody (0W6J4)

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] -

Immunohistochemistry: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry analysis of TIMM50 in paraffin-embedded mouse kidney tissue using TIMM50 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Applications for TIMM50 Antibody (0W6J4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM50

Tim50 is a component of the yeast Tim23 import machinery, which mediates translocation of presequence containing proteins across the mitochondrial inner membrane. By searching sequence databases, open reading frames encoding proteins with similarity to Tim50 and with a putative mitochondrial presequence were identified in the genomes of evolutionarily distant organisms, including human. Tim50 was found to interact with the N terminal intermembrane space domain of Tim23. Functional defects of Tim50 either by depletion of the protein or addition of anti Tim50 antibodies blocked the protein translocation across the inner membrane. A translocation intermediate accumulated at the translocator of the outer mitochondrial membrane (TOM) complex was cross linked to Tim50. Thus it can be concluded that Tim50, in cooperation with Tim23, facilitates transfer of the translocating protein from the TOM complex to the Tim23 complex.

Alternate Names

homolog of yeast Tim50, MGC102733, mitochondrial import inner membrane translocase subunit TIM50, TIM50, TIM50L, Tim50-like protein, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae), translocase of inner mitochondrial membrane 50 homolog (yeast)

Gene Symbol

TIMM50

Additional TIMM50 Products

Product Documents for TIMM50 Antibody (0W6J4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIMM50 Antibody (0W6J4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM50 Antibody (0W6J4)

There are currently no reviews for this product. Be the first to review TIMM50 Antibody (0W6J4) and earn rewards!

Have you used TIMM50 Antibody (0W6J4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...