TIPIN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83650

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TIPIN Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIPIN Antibody - BSA Free

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining in human testis and prostate tissues using anti-TIPIN antibody. Corresponding TIPIN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650]

Immunohistochemistry-Paraffin: TIPIN Antibody [NBP1-83650] - Staining of human testis shows high expression.

Applications for TIPIN Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIPIN

Timeless-interacting protein (TIPIN) was originally isolated as a protein that interacts with timeless, a factor that plays a role in circadian rhythm and cell cycle checkpoint regulation. The TIM-TIPIN complex has been shown to coordinate the intra-S-phase checkpoint in response to UV-induced DNA damage. TIPIN is required for cell cycle arrest in response to DNA damage. It also interacts with RPA (replication protein A) on DNA and is able to slow down DNA chain elongation in response to UV-damage.

Alternate Names

FLJ20516, TIMELESS interacting protein, TIMELESS-interacting protein

Gene Symbol

TIPIN

Additional TIPIN Products

Product Documents for TIPIN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIPIN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TIPIN Antibody - BSA Free

Customer Reviews for TIPIN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIPIN Antibody - BSA Free and earn rewards!

Have you used TIPIN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies