TM9SF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32382

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TM9SF4 Antibody - BSA Free

Western Blot: TM9SF4 Antibody [NBP2-32382]

Western Blot: TM9SF4 Antibody [NBP2-32382]

Western Blot: TM9SF4 Antibody [NBP2-32382] - Lane 1: Marker [kDa] 250, 130, 100,70,55,35,25,15,10. Lane 2: Human cell line CACO-2.
Immunocytochemistry/ Immunofluorescence: TM9SF4 Antibody [NBP2-32382]

Immunocytochemistry/ Immunofluorescence: TM9SF4 Antibody [NBP2-32382]

Immunocytochemistry/Immunofluorescence: TM9SF4 Antibody [NBP2-32382] - Staining of human cell line CACO-2 shows localization to mitochondria. Antibody staining is shown in green.
Simple Western: TM9SF4 Antibody [NBP2-32382]

Simple Western: TM9SF4 Antibody [NBP2-32382]

Simple Western: TM9SF4 Antibody [NBP2-32382] - Simple Western lane view shows a specific band for TM9SF4 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: TM9SF4 Antibody [NBP2-32382]

Simple Western: TM9SF4 Antibody [NBP2-32382]

Simple Western: TM9SF4 Antibody [NBP2-32382] - Electropherogram image of the corresponding Simple Western lane view. TM9SF4 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.
TM9SF4 Antibody

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] - staining of human rectum shows strong cytoplasmic granular positivity in glandular cells.
TM9SF4 Antibody

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human cerebral cortex shows strong cytoplasmic granular positivity in neurons.
TM9SF4 Antibody

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
TM9SF4 Antibody

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human prostate shows strong cytoplasmic granular positivity in smooth muscle cells and glandular cells.

Applications for TM9SF4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 lysate(s), separated by Size, antibody dilution of 1:25, apparent MW was 64 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TM9SF4

TM9SF4 is a gene that codes for a multi-pass membrane protein that is 642 amino acids long and weighs approximately 75 kDa. Current studies are being done on diseases and disorders linked to this gene including melanoma and malaria. TM9SF4 has also been shown to have interactions with RAB5A, ARCN1, UBC, HSP90AA1, and ATP13A1.

Alternate Names

KIAA0255dJ836N17.2, transmembrane 9 superfamily member 4, transmembrane 9 superfamily protein member 4

Gene Symbol

TM9SF4

Additional TM9SF4 Products

Product Documents for TM9SF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TM9SF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TM9SF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TM9SF4 Antibody - BSA Free and earn rewards!

Have you used TM9SF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...