TMED5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13440

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMED5 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440]

Immunohistochemistry-Paraffin: TMED5 Antibody [NBP2-13440] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
TMED5 Antibody

Western Blot: TMED5 Antibody [NBP2-13440] -

Western Blot: TMED5 Antibody [NBP2-13440] - Analysis in human cell line BEWO.
TMED5 Antibody - BSA Free Western Blot: TMED5 Antibody - BSA Free [NBP2-13440]

Western Blot: TMED5 Antibody - BSA Free [NBP2-13440]

Analysis in human cell line BEWO.
TMED5 Antibody - BSA Free Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Staining of human prostate shows weak cytoplasmic/cytoplasmic granular positivity in glandular cells.
TMED5 Antibody - BSA Free Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Staining of human duodenum shows moderate cytoplasmic/cytoplasmic granular positivity in glandular cells.
TMED5 Antibody - BSA Free Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Staining of human pancreas shows strong cytoplasmic/cytoplasmic-granular positivity in exocrine glandular cells.
TMED5 Antibody - BSA Free Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Immunohistochemistry: TMED5 Antibody - BSA Free [NBP2-13440]

Staining of human liver shows moderate cytoplasmic/ cytoplasmic granular positivity in hepatocytes.

Applications for TMED5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMED5

Alternate Names

CGI-100, DKFZp781B2248, transmembrane emp24 domain-containing protein 5, transmembrane emp24 protein transport domain containing 5

Gene Symbol

TMED5

Additional TMED5 Products

Product Documents for TMED5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMED5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMED5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMED5 Antibody - BSA Free and earn rewards!

Have you used TMED5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...