TNP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55356

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TNP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TNP1(transition protein 1 (during histone to protamine replacement)) The peptide sequence was selected from the N terminal of TNP1. Peptide sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TNP1 Antibody - BSA Free

Western Blot: TNP1 Antibody [NBP1-55356]

Western Blot: TNP1 Antibody [NBP1-55356]

Western Blot: TNP1 Antibody [NBP1-55356] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: TNP1 Antibody [NBP1-55356]

Immunohistochemistry: TNP1 Antibody [NBP1-55356]

Immunohistochemistry: TNP1 Antibody [NBP1-55356] - Human Adult Testis Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Applications for TNP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNP1

TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]. Sequence Note: removed 4 bases from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

spermatid nuclear transition protein 1, STP-1, TP1, TP-1, transition protein 1 (during histone to protamine replacement)

Gene Symbol

TNP1

UniProt

P09430 (Human)

Additional TNP1 Products

Product Documents for TNP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TNP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TNP1 Antibody - BSA Free

Customer Reviews for TNP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNP1 Antibody - BSA Free and earn rewards!

Have you used TNP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies