TRAPPC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13476

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: HCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRAPPC4 Antibody - BSA Free

Western Blot: TRAPPC4 Antibody [NBP2-13476]

Western Blot: TRAPPC4 Antibody [NBP2-13476]

Western Blot: TRAPPC4 Antibody [NBP2-13476] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: TRAPPC4 Antibody [NBP2-13476]

Immunocytochemistry/ Immunofluorescence: TRAPPC4 Antibody [NBP2-13476]

Immunocytochemistry/Immunofluorescence: TRAPPC4 Antibody [NBP2-13476] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476] - Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.
Western Blot: TRAPPC4 Antibody [NBP2-13476]

Western Blot: TRAPPC4 Antibody [NBP2-13476]

Western Blot: TRAPPC4 Antibody [NBP2-13476] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476]

Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13476] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
TRAPPC4 Antibody - BSA Free Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
TRAPPC4 Antibody - BSA Free Western Blot: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Western Blot: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
TRAPPC4 Antibody - BSA Free Western Blot: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Western Blot: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
TRAPPC4 Antibody - BSA Free Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.
TRAPPC4 Antibody - BSA Free Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
TRAPPC4 Antibody - BSA Free Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Immunohistochemistry: TRAPPC4 Antibody - BSA Free [NBP2-13476]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Applications for TRAPPC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAPPC4

TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi

Alternate Names

Hematopoietic stem/progenitor cell protein 172, PTD009, SBDNHSPC172, Synbindin, trafficking protein particle complex 4, trafficking protein particle complex subunit 4, TRS23, TRS23 homolog

Gene Symbol

TRAPPC4

Additional TRAPPC4 Products

Product Documents for TRAPPC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRAPPC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAPPC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAPPC4 Antibody - BSA Free and earn rewards!

Have you used TRAPPC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...