TRIAD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86907

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIAD3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLD

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRIAD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRIAD3 Antibody [NBP1-86907]

Immunocytochemistry/ Immunofluorescence: TRIAD3 Antibody [NBP1-86907]

Immunocytochemistry/Immunofluorescence: TRIAD3 Antibody [NBP1-86907] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907]

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

Applications for TRIAD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIAD3

The TRIAD3 gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (RIP). Zinc finger domains of the encoded protein are required for its interaction with RIP and for inhibition of TNF- and IL1-induced NF-kappa B activation pathways. The encoded protein may also function as an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known.

Alternate Names

EC 6.3.2.-, ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1, Triad domain-containing protein 3, TRIAD3Zinc finger protein inhibiting NF-kappa-B, U7I1, UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1, ZINE3 ubiquitin-protein ligase RNF216

Gene Symbol

RNF216

Additional TRIAD3 Products

Product Documents for TRIAD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIAD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRIAD3 Antibody - BSA Free

Customer Reviews for TRIAD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIAD3 Antibody - BSA Free and earn rewards!

Have you used TRIAD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies