TRIM15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82361

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TRIM15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM15. Peptide sequence: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRIM15 Antibody - BSA Free

Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361] - Host: Rabbit. Target Name: TRIM15. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: TRIM15 Antibody [NBP2-82361]

Immunohistochemistry-Paraffin: TRIM15 Antibody [NBP2-82361]

Immunohistochemistry-Paraffin: TRIM15 Antibody [NBP2-82361] - Rabbit Anti-TRIM15 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnific
Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361] - WB Suggested Anti-TRIM15 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateTRIM15 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361] - WB Suggested Anti-TRIM15 antibody Titration: 1 ug/mL. Sample Type: Human heart
Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361]

Western Blot: TRIM15 Antibody [NBP2-82361] - Host: Rabbit. Target Name: TRIM15. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Applications for TRIM15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM15

TRIM15 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

RNF93RING finger protein 93, tripartite motif containing 15, tripartite motif-containing 15, Zinc finger protein 178ZNF178, Zinc finger protein B7, ZNFB7tripartite motif-containing protein 15

Gene Symbol

TRIM15

Additional TRIM15 Products

Product Documents for TRIM15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM15 Antibody - BSA Free and earn rewards!

Have you used TRIM15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies