TRIM3/BERP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48897

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM3/BERP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRIM3/BERP Antibody - BSA Free

Western Blot: TRIM3/BERP Antibody [NBP2-48897]

Western Blot: TRIM3/BERP Antibody [NBP2-48897]

Western Blot: TRIM3/BERP Antibody [NBP2-48897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry: TRIM3/BERP Antibody [NBP2-48897]

Immunohistochemistry: TRIM3/BERP Antibody [NBP2-48897]

Immunohistochemistry: TRIM3/BERP Antibody [NBP2-48897] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Applications for TRIM3/BERP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM3/BERP

TRIM3 is encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified.

Alternate Names

BERPRING finger protein 97, Brain-expressed RING finger protein, HAC1, RING finger protein 22, RNF22brain expressed ring finger, RNF97FLJ16135, tripartite motif containing 3, tripartite motif protein TRIM3, tripartite motif-containing 3, tripartite motif-containing protein 3

Gene Symbol

TRIM3

Additional TRIM3/BERP Products

Product Documents for TRIM3/BERP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM3/BERP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM3/BERP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM3/BERP Antibody - BSA Free and earn rewards!

Have you used TRIM3/BERP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies