Tropomyosin-1 Antibody (5Q2H6)

Novus Biologicals | Catalog # NBP3-16689

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5Q2H6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin-1 (P09493). LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tropomyosin-1 Antibody (5Q2H6)

Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of extracts of various cell lines, using Tropomyosin-1 Rabbit mAb (NBP3-16689) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689]

Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of 600ug extracts of Rat heart cells using 3ug Tropomyosin-1 antibody (NBP3-16689). Western blot was performed from the immunoprecipitate using Tropomyosin-1 antibody (NBP3-16689) at a dilition of 1:1000.
Tropomyosin-1 Antibody (5Q2H6)

Immunocytochemistry/ Immunofluorescence: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] -

Immunocytochemistry/ Immunofluorescence: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Immunofluorescence analysis of paraffin-embedded mouse heart using Tropomyosin-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Tropomyosin-1 Antibody (5Q2H6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tropomyosin-1

Tropomyosin is a rigid rod shaped protein closely associated with actin filaments. Non-muscle forms of tropomyosin have been identified in a wide range of cell types.

Alternate Names

alpha tropomyosin, Alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, tropomyosin-1

Gene Symbol

TPM1

Additional Tropomyosin-1 Products

Product Documents for Tropomyosin-1 Antibody (5Q2H6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tropomyosin-1 Antibody (5Q2H6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tropomyosin-1 Antibody (5Q2H6)

There are currently no reviews for this product. Be the first to review Tropomyosin-1 Antibody (5Q2H6) and earn rewards!

Have you used Tropomyosin-1 Antibody (5Q2H6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...