Tubulin alpha-1B Antibody (ARC51243)

Novus Biologicals | Catalog # NBP3-23538

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # ARC51243
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-42 of human alpha Tubulin(NP_006073.2, P68363).

Epitope

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI

Localization

cytoplasm, cytoplasmic microtubule, microtubule cytoskeleton

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tubulin alpha-1B Antibody (ARC51243)

Tubulin alpha-1B Antibody (ARC51243)

Western Blot: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Western Blot: Tubulin alpha-1B Antibody [NBP3-23538] - Western blot analysis of lysates from HeLa cells, using Tubulin alpha-1B Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 0.5s.
Tubulin alpha-1B Antibody (ARC51243)

Immunocytochemistry/ Immunofluorescence: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunocytochemistry/ Immunofluorescence: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] - Confocal imaging of HeLa cells using alpha -Tubulin Rabbit mAb(Green). The cells were counterstained with RAB11A Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 60x.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded rat colon tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human cervix cancer tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded mouse testis tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human colon carcinoma tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human tonsil tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Tubulin alpha-1B Antibody (ARC51243)

Immunohistochemistry: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] -

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded mouse kidney tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Tubulin alpha-1B Antibody (ARC51243)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tubulin alpha-1B

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain

Long Name

Tubulin alpha-1B chain

Alternate Names

TUBA1B, Tubulin K-alpha-1

Gene Symbol

TUBA1B

Additional Tubulin alpha-1B Products

Product Documents for Tubulin alpha-1B Antibody (ARC51243)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tubulin alpha-1B Antibody (ARC51243)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tubulin alpha-1B Antibody (ARC51243)

There are currently no reviews for this product. Be the first to review Tubulin alpha-1B Antibody (ARC51243) and earn rewards!

Have you used Tubulin alpha-1B Antibody (ARC51243)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...