Tyrosinase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16989

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGVDDRESW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tyrosinase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Tyrosinase Antibody [NBP3-16989]

Immunocytochemistry/ Immunofluorescence: Tyrosinase Antibody [NBP3-16989]

Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody [NBP3-16989] - Analysis in human skin and skeletal muscle tissues using Anti-TYR antibody. Corresponding TYR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989] - Staining of human hair shows strong cytoplasmic positivity in medulla.
Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989] - Staining of human skeletal muscle shows low expression as expected.

Applications for Tyrosinase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tyrosinase

Tyrosinase is a rate-limiting enzyme in the melanin biosynthetic pathway and a complete defect of the enzyme activity caused by homozygous mutations of the tyrosinase gene is well known to result in tyrosinase-negative oculocutaneous albinism (OCA1A) patients who never develop any melanin pigment in the skin, hair and eyes throughout life (1). Tyrosinase catalyzes the first two steps of melanin biosynthesis. Mutations of the TYR gene have been identified in a large number of patients, most of Caucasian ethnic origin, with various forms of type I OCA (2). Type I OCA results from mutations of the gene encoding tyrosinase, the enzyme that catalyzes the first 2 steps of melanin pigment biosynthesis. In type IA (tyrosinase-negative) OCA tyrosinase enzymatic activity is completely absent, and in type IB ("yellow") OCA tyrosinase activity is greatly reduced. More than 80% of the known missense substitutions associated with type I OCA cluster within 2 relatively small regions of the tyrosinase polypeptide, suggesting that these may correspond to functionally important sites within the enzyme (3).

Alternate Names

CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)

Gene Symbol

TYR

Additional Tyrosinase Products

Product Documents for Tyrosinase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tyrosinase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tyrosinase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tyrosinase Antibody - BSA Free and earn rewards!

Have you used Tyrosinase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...