UBE2G1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13499

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UBE2G1 Antibody - BSA Free

Western Blot: UBE2G1 Antibody [NBP2-13499]

Western Blot: UBE2G1 Antibody [NBP2-13499]

Western Blot: UBE2G1 Antibody [NBP2-13499] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: UBE2G1 Antibody [NBP2-13499]

Immunohistochemistry-Paraffin: UBE2G1 Antibody [NBP2-13499]

Immunohistochemistry-Paraffin: UBE2G1 Antibody [NBP2-13499] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
UBE2G1 Antibody - BSA Free Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
UBE2G1 Antibody - BSA Free Western Blot: UBE2G1 Antibody - BSA Free [NBP2-13499]

Western Blot: UBE2G1 Antibody - BSA Free [NBP2-13499]

Analysis in human cell line BEWO.
UBE2G1 Antibody - BSA Free Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
UBE2G1 Antibody - BSA Free Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.
UBE2G1 Antibody - BSA Free Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Immunohistochemistry: UBE2G1 Antibody - BSA Free [NBP2-13499]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for UBE2G1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2G1

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins.

Long Name

Ubiquitin-conjugating Enzyme E2G 1

Alternate Names

E217K

Gene Symbol

UBE2G1

Additional UBE2G1 Products

Product Documents for UBE2G1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2G1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2G1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2G1 Antibody - BSA Free and earn rewards!

Have you used UBE2G1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail