Uroplakin IIIB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92564

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Uroplakin IIIB Antibody - BSA Free

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]

Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urninary bladder shws strong postivity in apical membrane in urothelial cells.
Uroplakin IIIB Antibody - BSA Free Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Staining of human placenta shows no positivity in trophoblastic cells as expected.
Uroplakin IIIB Antibody - BSA Free Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Staining of human liver shows no positivity in hepatocytes as expected.
Uroplakin IIIB Antibody - BSA Free Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]

Staining of human lung shows moderate membranous and cytoplasmic positivity in macrophages.
Uroplakin IIIB Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564]

Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564]

Staining of human cell line A-431 shows localization to nucleus & vesicles.

Applications for Uroplakin IIIB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-92564 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Uroplakin IIIB

UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B; MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of urothelial plaques are UPK1A (MIM 611557), UPK2 (MIM 611558), and UPK3A (MIM 611559) (Deng et al., 2002 [PubMed 12446744]).[supplied by OMIM]

Alternate Names

FLJ32198, MGC10902, p35, UP3b, UPIIIB, UPIIIbP35, uroplakin 3B, Uroplakin IIIb, uroplakin-3b

Gene Symbol

UPK3B

Additional Uroplakin IIIB Products

Product Documents for Uroplakin IIIB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Uroplakin IIIB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Uroplakin IIIB Antibody - BSA Free

Customer Reviews for Uroplakin IIIB Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Uroplakin IIIB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Uroplakin IIIB Antibody
    Name: Peter Caradonna
    Application: Immunohistochemistry
    Sample Tested: Placental tissue
    Species: Human
    Verified Customer | Posted 04/03/2017
    IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section.
    Uroplakin IIIB Antibody - BSA Free NBP1-92564

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...