Uroplakin IIIB Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-92564
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Uroplakin IIIB Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564]
Immunocytochemistry/Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564]
Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564]
Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urninary bladder shws strong postivity in apical membrane in urothelial cells.Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]
Staining of human placenta shows no positivity in trophoblastic cells as expected.Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry: Uroplakin IIIB Antibody - BSA Free [NBP1-92564]
Staining of human lung shows moderate membranous and cytoplasmic positivity in macrophages.Applications for Uroplakin IIIB Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP1-92564 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Uroplakin IIIB
Alternate Names
FLJ32198, MGC10902, p35, UP3b, UPIIIB, UPIIIbP35, uroplakin 3B, Uroplakin IIIb, uroplakin-3b
Gene Symbol
UPK3B
Additional Uroplakin IIIB Products
Product Documents for Uroplakin IIIB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Uroplakin IIIB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Uroplakin IIIB Antibody - BSA Free
Customer Reviews for Uroplakin IIIB Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Uroplakin IIIB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunohistochemistrySample Tested: Placental tissueSpecies: HumanVerified Customer | Posted 04/03/2017IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...