USP39 Antibody (1S9R9)

Novus Biologicals | Catalog # NBP3-16119

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1S9R9 expressed in HEK293
View all USP39 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 466-565 of Human USP39 (Q53GS9). KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for USP39 Antibody (1S9R9)

Western Blot: USP39 Antibody (1S9R9) [NBP3-16119]

Western Blot: USP39 Antibody (1S9R9) [NBP3-16119]

Western Blot: USP39 Antibody (1S9R9) [NBP3-16119] - Western blot analysis of extracts of Mouse liver, using USP39 antibody (NBP3-16119) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of U2OS cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of NIH/3T3 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/ Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119]

Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of PC-12 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human thyroid cancer tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse testis tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse lung tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse intestin tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse kidney tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
USP39 Antibody (1S9R9)

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] -

Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human colon carcinoma tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for USP39 Antibody (1S9R9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: USP39

USP39 may play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. Could be a competitor of ubiquitin C-terminal hydrolases (UCHs)

Long Name

U4/U6.U5 tri-snRNP-associated protein 2

Alternate Names

65K, CGI-21, HSPC332, PRO2855, SAD1 homolog

Gene Symbol

USP39

Additional USP39 Products

Product Documents for USP39 Antibody (1S9R9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for USP39 Antibody (1S9R9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for USP39 Antibody (1S9R9)

There are currently no reviews for this product. Be the first to review USP39 Antibody (1S9R9) and earn rewards!

Have you used USP39 Antibody (1S9R9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies