VCAM-1/CD106 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55858

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit VCAM-1/CD106 Antibody - BSA Free (NBP2-55858) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for VCAM-1/CD106 Antibody - BSA Free

Western Blot: VCAM-1/CD106 Antibody [NBP2-55858]

Western Blot: VCAM-1/CD106 Antibody [NBP2-55858]

Western Blot: VCAM-1/CD106 Antibody [NBP2-55858] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: VCAM-1/CD106 Antibody [NBP2-55858]

Immunocytochemistry/ Immunofluorescence: VCAM-1/CD106 Antibody [NBP2-55858]

Immunocytochemistry/Immunofluorescence: VCAM-1/CD106 Antibody [NBP2-55858] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.

Applications for VCAM-1/CD106 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VCAM-1/CD106

CD106 is a 110 kD glycosylphosphatidylinositol (GPI)-linked transmembrane protein, also known as VCAM-1 and INCAM-110. It is constitutively expressed on bone marrow stromal cells, myeloid progenitors, splenic dendritic cells, activated endothelial cells, as well as some lymphocytes. CD106 expression can be upregulated on endothelial cells by inflammatory cytokines. CD106 is involved in adhesion and acts as a counter-receptor for VLA-4 ( alpha4/ beta1 integrin) and LPAM-1 ( alpha4/ beta7 integrin). The 429 antibody has been reported to partially block VCAM-1-mediated binding.

Long Name

Vascular Cell Adhesion Molecule 1

Alternate Names

CD106, VCAM1

Gene Symbol

VCAM1

Additional VCAM-1/CD106 Products

Product Documents for VCAM-1/CD106 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VCAM-1/CD106 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VCAM-1/CD106 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VCAM-1/CD106 Antibody - BSA Free and earn rewards!

Have you used VCAM-1/CD106 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies