VDAC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80065

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2 Synthetic peptide directed towards the N terminal of human VDAC2. Peptide sequence MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VDAC2 Antibody - BSA Free

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065] - WB Suggested Anti-VDAC2 Antibody Titration: 1.6 ug/ml Positive Control: human cell lines
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065]

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP1-80065] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic
Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065]

Western Blot: VDAC2 Antibody [NBP1-80065] - VDAC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T

Applications for VDAC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VDAC2

Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Interacts with hexokinases. It is present in the outer mitochondrial membrane. There are 4 isoforms as result of alternative splicing. Expressed in all tissues examined. Consists mainly of membrane spanning sided beta sheets. Belongs to the eukaryotic mitochondrial porin family.

Alternate Names

FLJ23841, hVDAC2, Outer mitochondrial membrane protein porin 2, POR, VDAC-2, voltage-dependent anion channel 2, voltage-dependent anion-selective channel protein 2

Gene Symbol

VDAC2

Additional VDAC2 Products

Product Documents for VDAC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VDAC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VDAC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VDAC2 Antibody - BSA Free and earn rewards!

Have you used VDAC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...