VEGFR2/KDR/Flk-1 Antibody - BSA Free

Name: VEGFR2/KDR/Flk-1 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP3-25223
Price: 469 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-25223

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all VEGFR2/KDR/Flk-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein VEGFR2/KDR/Flk-1 using the following amino acid sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VEGFR2/KDR/Flk-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VEGFR2/KDR/Flk-1 Antibody [NBP3-25223]

Staining of human cell line HEL shows localization to nuclear membrane & vesicles.

Applications for VEGFR2/KDR/Flk-1 Antibody - BSA Free

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Application Notes

For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VEGFR2/KDR/Flk-1

Vascular endothelial growth factor receptor 2 (VEGFR2) is a member of a receptor tyrosine kinase family whose activation plays an essential role in a large number of biological processes such as embryonic development, wound healing, cell proliferation, migration and differentiation. Like other common growth factor receptors, VEGF receptor 2 dimerises upon ligand binding and is autophosphorylated at multiple tyrosine residues. These sites can be involved in the regulation of kinase activity or can serve as binding sites for SH2 and phosphotyrosine binding containing signaling proteins. Phosphorylation of Tyrosines 1054 and 1059 in the activation loop is required for activation of VEGF receptor 2 and its intrinsic tyrosine kinase activity.

Defects in the VEGFR2 gene are associated with susceptibility to benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium called hemangioma capillary infantile. HCI is the most common tumor found in infants, found in up to 10% of all births.

Long Name

Vascular Endothelial Growth Factor Receptor 2

Alternate Names

CD309, Flk-1, Flk1, KDR, KRD1, Ly73, VEGF R2

Gene Symbol

KDR

Additional VEGFR2/KDR/Flk-1 Products

Product Documents for VEGFR2/KDR/Flk-1 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VEGFR2/KDR/Flk-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.